DPCstruct | MC42195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 274 ± 25 aa |
| Standard deviation of domain lengths | 25.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5V978 | 1-350 | MEAFYLVRDFVPGEGDGRNGCGSQQSVEGEGEEMKRGGARGGGGKKGVFVLLGKHDLLAEGEREKRVEEIGGMFEERLGAFRERGVH… |
| A0A6A6R9D1 | 121-371 | WVALAKQDLLPPDTRDETVRKIKEEYESRLRALPQLLKWKIFSQPGLSLLEDDHVWQIFEEIHTTLEQQQKKRPGKEKSPIAPTTAM… |
| J4VV02 | 76-340 | None |
| A0A0F8UKL3 | 121-387 | None |
| A0A813D9K6 | 642-926 | None |
| A0A2J8ABS3 | 120-398 | None |
| A0A2U3EKK0 | 129-407 | None |
| A0A0G2HWP9 | 50-328 | None |
| A0A0L0NBZ0 | 118-374 | None |
| A0A0C9N2B9 | 1-264 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.