DPCstruct | MC42194
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 110 ± 9 aa |
| Standard deviation of domain lengths | 9.11 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L7X708 | 360-478 | IMLMHKVDMWPSVSVLHTFSKFARVSVFKPSHKHQARSSFYMIAQDVRAESEAAKTAVDEWKQIWWKTTCGGDQGTGKKLEEPSEKF… |
| A0A6A5V192 | 1-105 | MFSKFSNVRLFKPRKKHAVRSSFYMVATNVRPRSKDAQSAVLEWRTQWESATFGFDSAFLSCPCASGDHVSSLLAGFGPQLIDLATP… |
| A0A3D8QX11 | 475-574 | None |
| H0EL65 | 223-319 | None |
| A0A2I1CB53 | 74-193 | None |
| A0A6A6DNQ5 | 164-276 | None |
| A0A4U7ARN5 | 126-245 | None |
| W3X5G9 | 287-404 | None |
| A0A370U2U7 | 295-394 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.