DPCstruct | MC42193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 143 ± 17 aa |
| Standard deviation of domain lengths | 16.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5UXD6 | 29-152 | LEEEESIPEPILLTTAQFESLITTDLEFALELPEYPTTHKNGYTYCVNTTKVTDINHALVQYSWSQIHSPTTATSPFLNQARGKKWK… |
| A0A7R7VV79 | 28-174 | QPQQEKEENILIQLSDASTKPLKVLKLEYTSDLPEYPSTDPNGYGYVINVPPNQQRETVEDMVNSIQYCVRQNYRNRPSSHSSFLGT… |
| A0A1Y2E2R3 | 53-188 | None |
| A0A017S065 | 3-145 | None |
| A0A397TT60 | 250-382 | None |
| A0A397U5K6 | 42-187 | None |
| A0A397UL76 | 61-186 | None |
| A0A1Q5UA39 | 52-178 | None |
| G0RWH9 | 452-597 | None |
| A0A6A5WRN3 | 1-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.