DPCstruct | MC42190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 173 ± 22 aa |
| Standard deviation of domain lengths | 21.74 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 27.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5UL83 | 1-157 | MPSSVELDAIDKLALMPLTYWDTDSDDDIEDEPEPEEHSYFSGTACTIQFLRTRREDTRLSIRNIVIREDQQSLGDMASHARGLIPY… |
| A0A135U7M6 | 354-548 | CSVQHWAIPCEEVLNDLASGLDIDTDSRLAGAMTTKDRSNYRFSAAAAAVCFLQSMPEELRGHLRRIILDEDREAVAKPQCHALGLI… |
| A0A2P4ZF21 | 232-438 | None |
| A0A1B7XZW0 | 218-392 | None |
| A0A834RY37 | 23-182 | None |
| I1S3A3 | 27-231 | None |
| A0A6A5UWQ0 | 4-144 | None |
| A0A2H3H6V1 | 346-466 | None |
| A0A6A5SHQ6 | 239-413 | None |
| A0A6A6ZNB3 | 29-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.