DPCstruct | MC42188
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 74 ± 7 aa |
| Standard deviation of domain lengths | 6.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 47.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00067 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5UJ37 | 1-80 | MAYLEISLTIARTLWYFNFKKAPGAAGKLGEGDPRKKDGRERVEEFQIYESLVVDNDGPNLVFTPRGEHWRSLRFSGPCT |
| H1VBK2 | 2-60 | STALARTLFLYDLRKAVGVEDPAEGRPGRGEGRERVGEMQLFDTFTSMKDGPMLEFRAR |
| A0A6A6CDA6 | 83-148 | None |
| A0A2V1D8W4 | 1-78 | None |
| A0A4Z1HJD5 | 1-84 | None |
| A0A2P5HHD5 | 95-169 | None |
| A0A4Z1KGF7 | 20-99 | None |
| A0A7C8N1R3 | 725-798 | None |
| A0A7C8IIF6 | 1045-1117 | None |
| S3CJ81 | 910-981 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.