DPCstruct | MC42187
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 137 ± 24 aa |
| Standard deviation of domain lengths | 24.04 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 91.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 33.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I3MG60 | 1-136 | MLDSGSRGVGNRIGSYSIEKAKEEMERYFILDNLPNKDLAYLVEHTEIYDDYVNAVSWAQEFAELNRRVMMDIVLQCMSKFLSSFTT… |
| A0A808TI74 | 174-305 | FDPAVARPMGLDVGTVCVMIHCGSRGLGHQICTDHVREMEKAMGRYEIHVPDRQLACVPVRSPEGEAYLGAMVAAANYGRANRQLLT… |
| U6KGU1 | 150-308 | None |
| A0A2V3YL73 | 37-230 | None |
| A0A7J3WNL0 | 129-266 | None |
| A0A7W6FR58 | 29-180 | None |
| A0A0K0EKR2 | 1124-1246 | None |
| A0A7X6C873 | 307-466 | None |
| A0A2W1X318 | 169-301 | None |
| A0A674BA23 | 274-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.