DPCstruct | MC4218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 68 ± 9 aa |
| Standard deviation of domain lengths | 8.93 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.64 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6UB15 | 382-443 | RFDEGVRLLPGTVSALPACDAAKEGLLTAVTDASAATFNAALSGGGKHHVLGYCNGTNWTVR |
| A0A317HFJ5 | 1-84 | MRGEAVVANQRLMALAIFALADHIEGSSGYRFVPSTFAQLPSPAAVGSLACVSDSTVNIWGSVIAGGGGFTVLAFYDGSNWTVR |
| A0A7W7YBL3 | 469-533 | None |
| A0A659YPY9 | 156-217 | None |
| A0A5C7M5Q5 | 167-226 | None |
| A0A118KL55 | 355-424 | None |
| A0A317HHD7 | 1-81 | None |
| A0A132EE16 | 346-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.