DPCstruct | MC42175
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 183 ± 21 aa |
| Standard deviation of domain lengths | 20.75 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12739 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8XLK6 | 22-178 | EKHAVSVTDRETLELVMQKFLRNCLVPHVERLMRTLFEQLTARRGIIGKSLTSGMKKWFGGGSSANLASIPSVSFPPESLEMQSRKL… |
| A0A2D4KS81 | 5-177 | KKSNIWTPHGTCLTLTDHDRIRQFIQEFTFRGLLPHIEKTIRQLNDQLISRKGLSRSLFSATKKWFTGGKVPEKGVNELKSTSGLLY… |
| A0A0D0V039 | 275-479 | None |
| A0A438GKF2 | 35-213 | None |
| A0A819JXK0 | 6-200 | None |
| A0A1I8FJZ0 | 46-245 | None |
| A0A7R9Q4H1 | 302-524 | None |
| A0A3M6X1G2 | 422-571 | None |
| A0A2H2I4D7 | 273-457 | None |
| A0A0S7JDD7 | 273-437 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.