DPCstruct | MC42174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 377 ± 41 aa |
| Standard deviation of domain lengths | 40.58 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A850BH19 | 253-634 | NPVEEALQEDKLVHSDLFSPKAEILSAGYGFEGIIGVEGGEAEVRAAGGTWNKVTCGNGQEPARRVLTSSAEPNEVLTVDHADAMPI… |
| A0A848UG17 | 1-358 | MGFDGVIGWPDEELETIQTGGGSFYQPECADDPIVSGATAAGVEMFYRGVADDEPDYDDGLPVVFTWPVLTSTVHPQDFLFTLNTGE… |
| A0A2R4XG26 | 29-425 | None |
| A0A7S0GE38 | 3-284 | None |
| A0A7S3XAX5 | 72-462 | None |
| A0A3B8I4J9 | 4-302 | None |
| A0A1V8M5V4 | 286-680 | None |
| A0A853HS60 | 31-394 | None |
| A0A2E1V651 | 20-407 | None |
| A0A7Y2IRQ7 | 152-537 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.