DPCstruct | MC42170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 174 ± 12 aa |
| Standard deviation of domain lengths | 11.64 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 72.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 55.81 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF04667- PF14700 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3HZN3 | 61-226 | KELLNEMRKEQKKEVKMKNRRCREIERGMGNTKYQMLKRRQVKIETEAWEQAAKEYKELLMDMCEHKLAPNLPYMKSLFLGWFEPLR… |
| A0A397YWK1 | 99-255 | TETGTGAQKKYHSLKQRQVRLETEEWERAARECREIIEDMCEQKLAPNLPYVKSLFLGWFEPLRDAIRADLDAFKVKRGKIPYAPYM… |
| M0ZLT1 | 65-243 | None |
| A0A0B2PZ95 | 19-202 | None |
| A0A2P2MDM0 | 151-331 | None |
| A0A3N7I0S3 | 1-181 | None |
| A0A835J6E9 | 54-235 | None |
| A0A7J7NNN6 | 194-364 | None |
| A0A1J7G0I0 | 29-220 | None |
| A0A444FTS2 | 688-837 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.