DPCstruct | MC4217
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 57 ± 7 aa |
| Standard deviation of domain lengths | 6.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 46.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q1VZ40 | 1-46 | MKTLLHCSFCGKSQHDVENLVAGPAVFICNECVAKCNAFMALPIDA |
| A0A2W6B687 | 2-69 | AGPKHPRVQYRCSFCGKSQDQVHGLIAGPGGVYICDECIELCREIIAEELSASAAKRPQIPKVPNTSA |
| A0A4R2JE54 | 2-52 | None |
| A0A6J7VWL0 | 1-55 | None |
| A0A509JF29 | 1-60 | None |
| A0A1H7UZ38 | 13-71 | None |
| A0A1Q7HK72 | 1-67 | None |
| A0A535Q396 | 3-51 | None |
| A0A380QDK5 | 1-57 | None |
| A0A317IBD1 | 1-52 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.