DPCstruct | MC42169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 159 ± 24 aa |
| Standard deviation of domain lengths | 23.63 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.78 |
| Pfam Score | 98.53 |
| Assigned Pfam label(s) | PF05786- PF06127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y7L4R7 | 3-160 | LFDLEKHFAFYGAYHSNPINVLIHMVFVWPIAFSLSVLLYFTPSIFNFLPQIHFSLLGNDFHLIFNLGFCLTLIYCLFYISFDIKAG… |
| A0A6M4H4B0 | 4-156 | LAENLTQYAAYHRDRRNIATHFVGVPMIVFAIVLALATMSLPLDLGFPVTIAALVCVAGCAYYLWLDLTLGVAMVATMFVMLAMSSE… |
| A0A2S4L8A8 | 58-238 | None |
| A0A1S8W208 | 8-175 | None |
| A0A6P8HLE5 | 11-195 | None |
| A0A1V8T449 | 1-174 | None |
| A0A0A9DHW9 | 6-105 | None |
| A0A7Z2RLZ6 | 4-133 | None |
| W2PZ23 | 7-145 | None |
| A0A0B7NTX5 | 294-461 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.