DPCstruct | MC42167
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 6.36 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q08L08 | 103-192 | WGQRGQFLAVAGDVRALVEYEAGYGGPLNAHFQFHAIDLDRPFISATGYRSHFDTVRGCMTVDEAARGIMAAMLAEKKRPVLIEASY… |
| P52604 | 103-192 | WGQRGQFLAVAGDVRALVEYEAGYGGPLNAHFQFHAVDLDRPFISATGYRSHFDTARGCMTVDEVARGILTAMLAEKKRPVLIEANY… |
| J9S0P1 | 66-155 | None |
| A0A640VUG3 | 107-205 | None |
| A0A562P9D5 | 1-107 | None |
| A0A521QG74 | 50-144 | None |
| A0A220WPE6 | 90-192 | None |
| W7WYL8 | 63-150 | None |
| I1YLM9 | 92-179 | None |
| A0A103ELM0 | 95-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.