DPCstruct | MC42166
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 2.89 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q1VKV6 | 1-70 | MLAEDDPLILDLVEWVARDARSHAELLETWRTSCPHLTVWEDAVDRGYLTRQDRQVTVTRKGLELLSLHG |
| A0A1K1S4A6 | 50-120 | IEPLILDLLEWIGPRARPYDEVIDAWRTSCPHLPVWEEACARGYVVRHHVPGGIAEVNVSDAGRAHLRAAR |
| A0A1F2ZV83 | 1-75 | None |
| A0A5C8PKV2 | 1-67 | None |
| A0A1W9ICB8 | 1-75 | None |
| A0A1H4VWU9 | 1-74 | None |
| A0A854Q2E4 | 4-69 | None |
| A0A7T2RJN1 | 3-73 | None |
| A0A1M6AT82 | 1-69 | None |
| H1SCF5 | 22-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.