DPCstruct | MC4216
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 208 ± 25 aa |
| Standard deviation of domain lengths | 24.67 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5V8P1 | 27-230 | FIPDHGYGNSFDQVKNGDLNVGKKVHFTQCKTLDDMANNGRLNRYHINKNQNGLFEIVNNVGDTHTTKLMPCHNCLKILNYNDYLSI… |
| A0A2N3KDW1 | 42-283 | QSLEVNIEEVETGPLGLLTYKGEQVILYILQPRRSEYTLLNEPENSPKFHVAECSTLDKMRGQGRFDRYVVTSNTSGTFNVEFEEDY… |
| A0A1H6JX55 | 2-192 | None |
| A0A8A9ECE1 | 8-191 | None |
| A0A1Q3PBZ2 | 39-246 | None |
| J0UZF4 | 81-322 | None |
| A0A1H4ANV7 | 62-256 | None |
| A0A1G4YFD5 | 42-282 | None |
| A0A1W9VQ91 | 1-200 | None |
| Q0I2A0 | 40-268 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.