DPCstruct | MC42153
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 4.67 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A3ZKX8 | 1-67 | MGIYFSPAALAFYDGQLKDVYVKSGAWPSDIIEISEEKYKSLLTGQSAGKVISIDEQGNPMLVSPPP |
| A0A4D8RIN6 | 330-390 | MHMLYSASSRGFYRPDRDYQNLPADLVEVARDDYEALFAGQAAGAEIVPDESGRPVLAFPP |
| A0A377HWU3 | 1-73 | None |
| A0A6B1U9P0 | 4-78 | None |
| A0A1C4BVV1 | 1-60 | None |
| A0A376FB91 | 1-67 | None |
| A0A1D8UTE2 | 4-69 | None |
| A0A1I2QMV9 | 1-67 | None |
| A0A380X5D8 | 2-61 | None |
| A0A7X6C6F7 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.