DPCstruct | MC42152
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 238 ± 38 aa |
| Standard deviation of domain lengths | 37.63 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.12 |
| Pfam Score | 96.15 |
| Assigned Pfam label(s) | PF16972- PF11069 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151WJ85 | 2-186 | VRLHVKKGDDNQFLYDTDVEANVDDVISDIVVIYNGRLKISRICYEIEELAKHGVMLPPDIMGLTDDQVKELKLKDEWADKCVPMGG… |
| A0A182FQT1 | 1-252 | MVLLHVKRGEESQFLYETSTGVRVEQLGYELVTIYNGRLKVSRICSEIEELAKHGTMLPPDMLGLTDEQVEELHLVDEWADTCVPSG… |
| A0A0M4EA12 | 516-740 | None |
| A0A7J6PF63 | 442-690 | None |
| A0A4W2EYX3 | 1-258 | None |
| D2VBD0 | 1-155 | None |
| A0A2R6RTV8 | 2-186 | None |
| A0A5N5SYI2 | 89-335 | None |
| A0A1J1J0Y1 | 1-277 | None |
| A0A2R8ZAJ1 | 181-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.