DPCstruct | MC42147
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 135 ± 15 aa |
| Standard deviation of domain lengths | 14.82 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 28.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07670 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A192F8B1 | 7-156 | SQLVRGRLKFIVMSLIGIILFLVPITVTEDGVKQTTLPVAFLAGLLQDVLGNAMPLIIVLIVTISGILSILCSTILKNKLKPDGLLY… |
| A0A354KRX8 | 13-116 | TNLVNILKFAIATILGFLLVVIPFNFDGTVDTISFYYLKLLKSSLGNVLTFTVVSVVALSGIVSLITLLFKPKFILENKTLKSLFST… |
| A0A1M7YY45 | 13-155 | None |
| A0A1B8P7C3 | 12-135 | None |
| A0A2D8AK00 | 2-119 | None |
| A0A061NTY0 | 2-134 | None |
| T0E201 | 2-110 | None |
| A0A090SIN8 | 8-158 | None |
| A0A812ZDR3 | 614-763 | None |
| A0A090S8Z0 | 9-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.