DPCstruct | MC4214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 331 ± 48 aa |
| Standard deviation of domain lengths | 48.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 66.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.62 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0706 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4HH77 | 3-320 | AAARAEARRKAILSRGSDRLSKLTTSARGDSPVYMHDDPPLPSIPRTSDFVGEETTAMPTRPSPGPSPHRQASSSIPGPDPSVWSEA… |
| A0A067NQA1 | 3-301 | AAARAEARRKAILSRGGDRLAKLTTSARGEDGSSYLNTDAPASNSRAFVGDESIMPTPPARTSPSPHLPADAFVAPNVDPSVWSQEQ… |
| A0A081CKD4 | 21-387 | None |
| A0A3N4KVU5 | 1-316 | None |
| J6F2X8 | 5-373 | None |
| A0A1C7N7U1 | 1-257 | None |
| A0A2Z6R2Y6 | 8-416 | None |
| Q6FPJ3 | 2-279 | None |
| A0A137QG06 | 191-539 | None |
| A0A550BXG4 | 9-419 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.