DPCstruct | MC42137
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 66 ± 5 aa |
| Standard deviation of domain lengths | 4.79 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 39.92 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848I795 | 9-73 | QVFMSAGLIVKRQECSLCGDDYEKCDHIAGRPYMGRLCAVVLKEVTPDHVALVEAPANRRCRITA |
| A0A6M8W0R6 | 96-158 | VFASVSFIVEESECSICHAAYGECDHIKGRPYMGELCARIVTKCDVQEVSLVEEPASKHCRLT |
| A0A1G8C681 | 144-206 | None |
| A0A2I2M2M9 | 128-198 | None |
| A0A5J4KGD8 | 142-204 | None |
| A0A0D4DHB8 | 37-99 | None |
| K7WJW4 | 139-211 | None |
| A0A119A8W7 | 55-129 | None |
| A0A117R0U0 | 104-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.