DPCstruct | MC42133
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 94 ± 6 aa |
| Standard deviation of domain lengths | 5.78 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S8AUT0 | 1-106 | MTILSEVRPGAYFDSVILMQLQRSLADLPGVIDVGVVMATPANKELLAASGLAVESPAGSDDLLIVVKAKDKKMAGDALSQGVSLKN… |
| A0A380Z842 | 1-92 | MLLLNQLKPNTYFDSVTLMAISTKVNQLEGVIQAQIAMGTPMNKAVLKEAHLFDSQLEKAGPSDLMIALSLEKGASEQKILSEVEKL… |
| A0A3P6KJV8 | 1-90 | None |
| A0A2P2CFX5 | 1-96 | None |
| A0A6G9I9N3 | 302-399 | None |
| A0A1H9SHS8 | 1-86 | None |
| A0A2W4M8G5 | 9-103 | None |
| A0A376L1E4 | 1-92 | None |
| A0A2V6NZ37 | 1-87 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.