DPCstruct | MC42129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 84 ± 8 aa |
| Standard deviation of domain lengths | 7.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E7IBR5 | 1-78 | MTIMIKTHFMGEERTLVPEIGQRYKVVPMNIAKAKNAGRVCTLLELDDDFMPQKGSVKWEDTGRKGSVNLSDLILHKS |
| A0A168NP73 | 5-95 | KIANGYRVEFMYYVDKKRFKRTTNIQLNQRYVVVPPLYSKQLKMLDRECIIVDFLEDESGFVHKAKVRYIDNNRVGRMSFENLVSKD… |
| A0A848CN78 | 18-98 | None |
| A0A518JQ54 | 3-82 | None |
| G2FLU0 | 11-90 | None |
| A0A3S8RXH4 | 5-99 | None |
| A0A2N2B6I7 | 4-88 | None |
| A0A559U350 | 5-93 | None |
| A0A0K2WGI5 | 57-137 | None |
| A0A0K2F6S4 | 12-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.