DPCstruct | MC42125
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 133 ± 7 aa |
| Standard deviation of domain lengths | 6.85 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 87.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 24.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A178XEV5 | 1-125 | MSDAVSALERKGLLIRSPGSDGRRRLLALTDRGFQVSAELSAWDEQLVAALPEPDRATTLHTLLRVIADLQRSGAISVARVCTTCRF… |
| A0A4R1IEQ7 | 8-135 | SDVVSTLEEKGLVENRRAIDDGRALAVRLTGRGRTAAKRALQWPAFLGKAVGALHADEQPAFYRTLLKTIHQLEVQEQMPPHRMCLS… |
| A0A7Z9WS68 | 67-196 | None |
| Q8ZUP6 | 45-167 | None |
| A0A3E1NXN1 | 132-265 | None |
| A0A160UP45 | 7-136 | None |
| A0A7W6XKY7 | 20-163 | None |
| A0A5J4DYV2 | 20-158 | None |
| A0A853HSY1 | 67-197 | None |
| A0A7M2XFI7 | 54-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.