DPCstruct | MC4211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 180 ± 17 aa |
| Standard deviation of domain lengths | 17.40 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A4Z045 | 1-160 | MISVAGGWVVELVYCFVSEAQFLEGIRTFCLLWLASAAAFFCGTIIGFLFAVPKSLSSPDTAAAQRIGRYRGNTNLEEVSDWLTKII… |
| A0A1V4UGA4 | 16-234 | LESHIAQALFILGIFAVGGIIFIFFFALHVPYEMSLVNMTVANATNATIPVETGTKILSSWDSAFSVISVFGVGVLVAGGSFFLGGL… |
| A0A418QRV9 | 12-200 | None |
| A0A529J401 | 10-223 | None |
| A0A7W6JF79 | 5-201 | None |
| A0A318HQ27 | 12-211 | None |
| A0A150XA67 | 12-180 | None |
| A0A838N8T5 | 31-211 | None |
| A0A428MN80 | 99-283 | None |
| A0A7Z7ZPM2 | 43-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.