DPCstruct | MC42109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 287 |
|---|---|
| Mean domain length (aa) | 275 ± 49 aa |
| Standard deviation of domain lengths | 48.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.85 |
| Pfam Score | 94.60 |
| Assigned Pfam label(s) | CL0059- PF00557- CL0613- PF00067- CL0429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L9ZKF2 | 160-450 | CPFSDEINPHAEEVRAQSQEWAQELGMIDEPSQRIDTVSRLGCQLHPQASLESMQLCSDWYSWVFAHDDDLDPTELGTNPEAVESFH… |
| A0A386KZ50 | 102-449 | FYCPFEPSLSPHYLELYGSRDERASIYETTMKKYNRINSEKTSAICTPYSSYGDTQIVAYFYSMMYYINDQTAHLKLPESEIESELI… |
| A0A4Y9TEF1 | 5-247 | None |
| A0A0F7TXH9 | 1-210 | None |
| A0A199VT57 | 692-988 | None |
| A0A1V6PI15 | 2-306 | None |
| A0A117NL83 | 13-258 | None |
| S7PZ44 | 12-252 | None |
| Q5AY20 | 2-349 | None |
| A0A6A6ACK3 | 13-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.