DPCstruct | MC42108
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 169 ± 30 aa |
| Standard deviation of domain lengths | 29.83 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 74.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L7JD47 | 105-266 | SPVADAPAAEAPADAVANQTKSLSSCPKGTILKGLNYFKDKSDPVALADDAYPAWLWDCLSVTKKAAAVDADSGADEFSKSKKQRRL… |
| A0A1V8T461 | 3-147 | AAKVAPPRMPSSVPAGTLLKGLNYIKGKQDPVALEDEEYPEWLWSVLEKAQKSDGAAAGGDENDLFSKSKKQRQRAAKSLRKRALLH… |
| A0A177VE91 | 143-375 | None |
| A0A163KSE4 | 643-817 | None |
| A0A3M7LX41 | 348-533 | None |
| A0A366QP65 | 132-310 | None |
| A0A4S2N4W4 | 2-209 | None |
| A0A7R7VVH2 | 135-322 | None |
| A0A4S8U1X3 | 92-279 | None |
| A0A5N6JV58 | 49-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.