DPCstruct | MC42100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 126 ± 16 aa |
| Standard deviation of domain lengths | 15.74 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 91.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00771 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A090QYF9 | 203-354 | GNVDGILTKDPAYGMEAVWISTSDKDKAVNLGYTVVDHATIISTHVSKVINDHIEDILGPVEVNGILERLSTVNSKLADDLQNKLTH… |
| A0A2E2R7U0 | 1-136 | MLEKDVVTGKYDMLCDPLQKTLLDQHKLEYLTFETRLVTQIEALLVQKVDQLFTLNEYQRHMTTLGDKYTEQLKELERVLPVTKVVE… |
| A0A381H8J3 | 337-513 | None |
| A0A6I1ZJH2 | 195-312 | None |
| A0A090T1Z1 | 83-201 | None |
| A0A7C3R7K5 | 8-129 | None |
| A0A2E2IR96 | 154-280 | None |
| A0A1Q6V1E7 | 1-100 | None |
| A0A6L4ZP52 | 140-258 | None |
| T0DZM0 | 1-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.