DPCstruct | MC421
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 97 ± 16 aa |
| Standard deviation of domain lengths | 15.57 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U9K2N4 | 1-76 | MTRNLDHRVEAAVKIHSKKLKHELLEMLEIQLRDNVKARYLNNKQTNEYVHNDEPICRSQIVIHNYLKSKAEEQEI |
| A0A2G9XNP0 | 2-100 | YYFHNGGDPEIYSGSADWMPRNFKKRAEILYPIKNTALKSRIMDEILMTYLKDNVKARLMQPDGSYVRIKPKSGEKLVRSQNELIAI… |
| A0A7Y2NVT5 | 1-89 | None |
| H1LIV9 | 1-79 | None |
| A0A162FX58 | 1-82 | None |
| A0A380ZUS0 | 1-78 | None |
| A0A644Y4R0 | 540-637 | None |
| A0A316P363 | 641-771 | None |
| D4IVH2 | 1-71 | None |
| A0A7V5C8E9 | 103-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.