DPCstruct | MC42097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Standard deviation of domain lengths | 9.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 82.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 58.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447U2U5 | 1-92 | MGGKEALRQCAPHWDIAGQGEWHDNTIRLTSLSTGFDQLHYGAMTVTSPRLALNKPIVWVRDATTPSLQGALSLVAGKTVFTSGSVL… |
| A0A6M1I3W8 | 119-184 | MQARWDVKGSGEWRDNAITLSSLSTGFDKLEYGTMRVSTPRLTLEQPIRWLRDAEHPRLTGALSLD |
| A0A376U9Y5 | 1-85 | None |
| A0A376TH42 | 43-122 | None |
| A0A447R3X2 | 1-65 | None |
| A0A3S4DLC2 | 5-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.