DPCstruct | MC42094
Metacluster Properties and Pfam Annotations
| Number of structural domains | 72 |
|---|---|
| Mean domain length (aa) | 148 ± 18 aa |
| Standard deviation of domain lengths | 17.95 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496M2X0 | 123-294 | IDEAIEKGSNLHDLADYAVIQINDTHPSLVIPEMIRLLTERGLDLDEAIAIVQKMTAYTNHTILAEALEKWPLEFLKEVVPHLVPII… |
| A0A447TTG7 | 1-141 | MNDTHPTIAIPELLRVLIDEHQLSWDDAWAITSKTFAYTNHTLMPEALECWDEKLVKALLPRHMQIIKQINDRFKTLVDNTWPGDKQ… |
| A0A7J7GWT1 | 124-251 | None |
| A0A814K3D9 | 377-532 | None |
| A0A4S4EB45 | 220-389 | None |
| A0A357B459 | 111-245 | None |
| A0A6A4V0U7 | 259-392 | None |
| A0A643C449 | 671-818 | None |
| A0A2P4SCN2 | 112-250 | None |
| A0A0G0PRV0 | 179-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.