DPCstruct | MC4209
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 156 ± 26 aa |
| Standard deviation of domain lengths | 26.42 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2S7UXF6 | 1-137 | MPSQDNVAALTEHLSQKMPEFLTDNNIPEPPSTIQYDNQGQIQLPADYPYATQFKRALEETPTLARELQTVNALASHVNEMKKLIPF… |
| A0A840MVP9 | 17-154 | EGVIRLIGDIRRGVLHLDDVRQVAASVLERYGHYLNECLTDAGIIIPPAVDLTTGETGAIQVLSHPQAATILAVFQQNERLIRGFKE… |
| A0A327KL26 | 35-193 | None |
| A0A1D9BA97 | 1-112 | None |
| A0A7Y7DKS6 | 26-207 | None |
| A0A2A4Z3D2 | 217-339 | None |
| A0A517ZTR4 | 34-216 | None |
| A0A7J0BR36 | 14-193 | None |
| A0A2S0P7M4 | 5-126 | None |
| A0A7Y7D4J2 | 224-343 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.