DPCstruct | MC42085
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 392 ± 33 aa |
| Standard deviation of domain lengths | 33.29 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A223M8Z3 | 1-442 | MPSTESTNVWEYEDESKNPVINRMKKHNQSRTFNTPGYWGLSPYDISNGNFPGWTRTNKSSEFSSEIGSEYTNSIKVYEYSPNDENE… |
| A0A502M2H2 | 1-354 | MVDINGDKKDDGIRVYEYKPDADNDTVKDKSERKYIAKLDATNKKGYDKFLKFIKENPTISGIIIENMGLVDKKQDFSQILSQIPPS… |
| N9SR00 | 176-586 | None |
| A0A3G8LG54 | 467-885 | None |
| A0A168RKS3 | 728-1152 | None |
| F9QDU7 | 116-507 | None |
| A0A4R6IAS0 | 386-774 | None |
| Q8EWR5 | 161-503 | None |
| A0A6M4JD31 | 423-776 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.