DPCstruct | MC4208
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 58 ± 5 aa |
| Standard deviation of domain lengths | 4.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 58.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06945 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R3LJQ9 | 173-231 | DTTPDTPCIAICSTNQGDAVCKGCGRTHDEVTRWPALTPGEKRAVWRRITREGSAWRFN |
| A0A2M6UZS1 | 68-128 | NTTPDAPCIAICSTSQGDEECKGCGRTFEEVQHWPGMTPSEKRSTWRRITMIGTSWRFNKY |
| A0A7C9GZS1 | 29-92 | None |
| A0A7G6A971 | 60-113 | None |
| A0A328ZPN3 | 68-126 | None |
| A0A4R3M2A9 | 18-64 | None |
| A0A1F4N570 | 68-128 | None |
| A0A853FBE4 | 46-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.