DPCstruct | MC42079
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 167 ± 17 aa |
| Standard deviation of domain lengths | 16.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20557 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A857JAE7 | 1-175 | MPLTVDTGAGNPAADSFVSLADATAYHSSIGNTAWADLAPDVQEQRLRRATAFMEQAYRMRWAGTRVTSTQALSWPRAWVPMPDAPG… |
| A0A0Q2U946 | 1-166 | MALDTTIGGTASDSYVTFAEFQAYWTARGVNMTQHGHDTSHEANLRSAAQYLDSFYRFVGMKQYQFQARAWPRLVNQLVDDWPIDPD… |
| A0A7C7C2X3 | 104-270 | None |
| A0A432QX62 | 1-184 | None |
| A0A6N8WBV5 | 1-174 | None |
| A0A524QZ02 | 4-195 | None |
| A0A7K3ZI49 | 5-136 | None |
| A0A5B0DV29 | 3-144 | None |
| A0A525HIE1 | 1-158 | None |
| A0A4D8QDR8 | 1-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.