DPCstruct | MC42078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 113 ± 16 aa |
| Standard deviation of domain lengths | 15.78 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 94.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| N9QPL0 | 3-104 | KIIIAGFQHETNTFAPTKASYADFVQGGGFPPLSRGADVLKFREQNIPIGGFIQQAEQFGYQLLPVIWAGTSPSAHVEQCTYQRICD… |
| V4XPE8 | 5-112 | TVLVGGFAHETNTFAPTPTGRKQFQQRLERFGEAVPAELRGTNTGIGGVIDVADDAGVDLIHTVAASATPGGHVTEAAYEFYTGEIL… |
| R8BHQ3 | 351-488 | None |
| A0A3M1D9S7 | 152-290 | None |
| A0A4P5SSF6 | 12-141 | None |
| A0A3C1GCK7 | 2-97 | None |
| A0A4V2D886 | 1-90 | None |
| A0A0D2H738 | 5-125 | None |
| A0A3A0B590 | 59-150 | None |
| A0A446C915 | 481-592 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.