DPCstruct | MC42076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 104 ± 13 aa |
| Standard deviation of domain lengths | 13.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.51 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04961 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N3BMM1 | 1-115 | MTQISLASYLANLPVACFIENVAAKSPAPGGGSVAALSGALGAGLGAMVCRLTIGKKKYKDVEDELRAAEEKLAPLVEKLRDLVDED… |
| A0A2J0LFZ3 | 3-95 | DDSIKKYTEDLGSNNPVPGGGSAAALIGSLGAGLLEKACNFTIGREKYKAVEKDIRNILDKAAAARSRLVELIELDKKAFLPVAKAY… |
| A0A2H0WWP7 | 6-96 | None |
| A0A834CIT3 | 235-334 | None |
| X1IHM1 | 4-96 | None |
| A0A6A4W262 | 276-389 | None |
| A0A848M3H3 | 1-109 | None |
| A0A0E9WNV7 | 1-101 | None |
| A0A1C6KAJ2 | 218-336 | None |
| A0A6I9Q0X4 | 50-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.