DPCstruct | MC4207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 86 ± 13 aa |
| Standard deviation of domain lengths | 12.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.70 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 36.46 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A424RYP4 | 2-70 | HALMSEMRALQSKIKDECRDVGDEFAEEARKIHYGEVEPEGIYGQATEEEREALDEEGIAVMDIPWLPK |
| A0A840MSR5 | 9-87 | TGAEQSETIDVGALLMKVRAQVLTQSEDVGTRFAAEARKIHAGNAPERMIRGVVSRDEVVELLEEGVPVMPFPDPVDDN |
| A0A535BJR6 | 138-231 | None |
| A0A2A4ZQ82 | 46-118 | None |
| F3LS79 | 46-143 | None |
| A0A520N9V2 | 115-196 | None |
| V4Y0N3 | 81-176 | None |
| A0A511FM43 | 2-73 | None |
| Q0G7Y9 | 27-127 | None |
| A0A5A7MV98 | 61-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.