DPCstruct | MC42069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 10.76 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6DR31 | 238-328 | STPTYCVEIKPKQGWLPSVDRRYPKCTFCLNQFLKLANHTVKVRSEYCPLDLFSGDSLRMKKAIGALLKTPQNNLKIFKDGQLVYSE… |
| A0A7J7I2W1 | 123-220 | HSNLKGKFSISVEIKPKCGFLPDSRFISEENAIKKRITRFKMHQSLKLHQREISDTSEYDPLDMLSGSKERVHKAITALFCTPQNNF… |
| A0A7R8CCG3 | 92-187 | None |
| A0A068VAP2 | 34-145 | None |
| A0A1Y2GZ82 | 150-273 | None |
| A0A811P0Z0 | 74-172 | None |
| A0A0D2R035 | 48-146 | None |
| A0A0C2JYE7 | 117-217 | None |
| A0A397JEX1 | 187-283 | None |
| S4RD21 | 103-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.