DPCstruct | MC42066
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 109 ± 10 aa |
| Standard deviation of domain lengths | 9.68 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2MSY4 | 3-91 | FGVVVVPREGEKVGNERPSDRILVAQPAAGNAATFSSTKVRTALAKGDEAAIAAMICPEAARLLVRPTVDEHMAFVRDYDQLRVPAP… |
| A0A812H6Y9 | 154-268 | RVFYACGTDHAKRCGLYQGFGRFGGEAENVGVVVVPREGEVAQPESPGKFVFVASAAPGDVASFSSTKIRESFKTAGPEEHEYLCHA… |
| A0A7S2H0S1 | 1-107 | None |
| A0A812NX88 | 28-126 | None |
| A0A812W2V5 | 210-324 | None |
| A0A812QBQ8 | 81-196 | None |
| A0A813HAP8 | 39-148 | None |
| A0A812XNK6 | 51-175 | None |
| A0A7S4SXB1 | 702-802 | None |
| A0A7S1L243 | 69-175 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.