DPCstruct | MC42062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 90 |
|---|---|
| Mean domain length (aa) | 149 ± 38 aa |
| Standard deviation of domain lengths | 37.96 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 21.44 |
| Pfam Score | 98.98 |
| Assigned Pfam label(s) | PF12014- CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2JB64 | 1-147 | GLFTADYGVHGPEVIEVRLARLHSDAPTYELVGIKLTGDRHVPAGQRTWSAALPKEPSTHSPHPCLGAPSASAPQGAQLPSQSAALI… |
| A0A1Z5KQN3 | 171-297 | GLWVGRYGNHGFEMINITYAGDTMIAYKVTDNDNVPSGEVSFTVDLSPNPKTIHGETPLLEPIELNHDAAEQWGLKYLPRFTGRGQV… |
| A0A3L6PPE1 | 370-520 | None |
| A0A2S4UK84 | 351-513 | None |
| B7G3D6 | 218-346 | None |
| Q2GQA2 | 25-188 | None |
| M8B160 | 1-174 | None |
| A0A1D6GL50 | 171-264 | None |
| A0A5K1JVG2 | 147-271 | None |
| A9T024 | 2-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.