DPCstruct | MC4206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 191 ± 38 aa |
| Standard deviation of domain lengths | 38.46 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.54 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 24.96 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9AWJ4 | 2-180 | EDCADQARTDVLLQHEGVFARPVPSPAECKRLTVDAQGRSVTWAIRLGLEMHEAALRCAQMKLERIRPGGFSLEPRYRFNRGTKEKE… |
| A0A840MNQ9 | 2-184 | CKCQGEPVKGRDGRDLKQACVSGRLSELDQVLQRRSPYKAEVSYDMTQDPPRPIMDRRQPTKPHGWLPGWLAKYWDEPEAQRPAWEA… |
| A0A1I3ZE60 | 59-259 | None |
| A0A1I3SIT2 | 17-278 | None |
| A0A060URJ3 | 3-124 | None |
| A0A348HF46 | 32-228 | None |
| A0A2A7SJK0 | 1-221 | None |
| A0A378WH45 | 35-210 | None |
| A0A4U1J797 | 224-410 | None |
| A0A1V3IDG5 | 17-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.