DPCstruct | MC42054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 235 ± 18 aa |
| Standard deviation of domain lengths | 17.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 37.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A318NFN1 | 27-259 | LVATQPNGRPVVQLPDRYRLGSWAAVLGARPEDLRDADGGHDIDRDLRDGYVTLPWAGADPVREYVRHAGRGTAAGRLIVVAARPDA… |
| A0A4Q7W5B2 | 1-275 | MVGSQRDGQPVVQLPGRYRLARWAGAFRVRPDDLTDLDGACGLDQYLRDGIVRLPDPDADPLTRYVDHASRAHPGARRFVRASRPDV… |
| C4RB85 | 88-319 | None |
| A0A4V2Y2J0 | 442-671 | None |
| A0A3N1A7J5 | 1-239 | None |
| A0A1C6UYB6 | 4-212 | None |
| A0A495JKY0 | 235-450 | None |
| A0A4R4N4H8 | 196-445 | None |
| A0A7W7SQN7 | 451-693 | None |
| A0A3N1A6V9 | 367-588 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.