DPCstruct | MC42052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 209 |
|---|---|
| Mean domain length (aa) | 139 ± 21 aa |
| Standard deviation of domain lengths | 21.28 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 90.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.04 |
| Pfam Score | 99.28 |
| Assigned Pfam label(s) | PF00330- CL0159- CL0364 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V5NDJ8 | 248-399 | AASIWATGRTWWQIPPIAKVTFSGVLPVGVTGKDVIVALCGLFNNDEVLNHAIEFTGSEQTMRSIPVDDRLAIANMTTEWGALSGLF… |
| A0A6D0EK43 | 69-213 | LNRMLLPDTVGTGGDSHTRFPIGISFPAGSGLVAFAAATGVMPLDMPESVLVRFKGKMQPGITLRDLVHAIPLYAIKQGLLTVEKKG… |
| A0A7M3RRE8 | 329-470 | None |
| A0A377D2L5 | 103-259 | None |
| A0A1M7PF56 | 139-284 | None |
| A0A7C7PDK4 | 94-233 | None |
| A0A4S4D064 | 254-333 | None |
| A0A3Q0JB04 | 122-266 | None |
| A0A835HGM6 | 13-125 | None |
| A0A850R341 | 49-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.