DPCstruct | MC42050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 425 ± 33 aa |
| Standard deviation of domain lengths | 33.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397FBW4 | 66-431 | LSHWFTDEIIQKGRRLDIKNTSTTQTFAVSFYRVYSKSYCTVCVPLATLGHGTCNLTVQYIQRTNMVVVTKILIGMAGFVASRKTVQ… |
| A0A1V9ZAG3 | 190-631 | VSVSTLTSLGFVPTRLGSDLRLTSAFAVANTTTTAPTSVNVSLYRIYSKSFCSACVPIAELGLLTCTLDYTYNATSRKLVVSSSRGI… |
| A0A397FD36 | 616-1038 | None |
| A0A485KG67 | 85-454 | None |
| A0A1W0ACL8 | 444-872 | None |
| W2LNV7 | 7-407 | None |
| K3WFZ8 | 251-675 | None |
| A0A3R6Y8V7 | 420-922 | None |
| A0A3R7WFB4 | 1-443 | None |
| A0A6G0WMS2 | 14-465 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.