DPCstruct | MC4205
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 175 ± 22 aa |
| Standard deviation of domain lengths | 22.29 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7L5C8A7 | 19-202 | QNLKNDIAKAYRDYGRLFATYHHVPPDSSWIDISFLSKDKTKIYSCAIRNAIVAIDEKSGQLAHNEAYEIVLYNPELEDPVFKHFVE… |
| A0A840MKK1 | 15-184 | QYHRMNPWRLTLGLYIPHSYPDLKPLSWWDDVGFVLGGRRVMVWWVHPRRRYLDEIEARALRDAGPMPDDEAFGKSIGKYCKRVGRS… |
| A0A3M0MNH8 | 1-172 | None |
| A0A0N0D049 | 7-152 | None |
| A0A1I1ESK9 | 2-196 | None |
| A0A1F1DZU6 | 18-211 | None |
| A0A6J7WBD9 | 26-239 | None |
| A0A849U739 | 19-190 | None |
| A0A285B851 | 22-184 | None |
| A0A2S5QT00 | 6-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.