DPCstruct | MC42043
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 118 ± 14 aa |
| Standard deviation of domain lengths | 14.46 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.65 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | CL0110- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3HNY1 | 1-104 | MPLHLYTRGDDVPIPFVGFLPNMLTVDNNSALEMVYRANVGGQTIPPDQDTGMFRTWNADESYIFGAAYGQIDFDNTLSIQYPKTVP… |
| A0A6P5RJ80 | 198-318 | SMPNYLYYTSAQNSDGVNYIGSENTFRIENGTALEMVYRFNVGGSSLLFNKDTGMYRKWDGEQDEYKYLDYSSKKFSVLPQNSSIEL… |
| A0A2G3B2S0 | 26-169 | None |
| A0A1R3HP07 | 539-666 | None |
| A0A6A6KVS5 | 119-227 | None |
| A0A2P2MV49 | 1-113 | None |
| A0A396IBN0 | 5-141 | None |
| A0A2P6SAD5 | 58-198 | None |
| A0A1S3W104 | 1-85 | None |
| A0A2R6RKH6 | 199-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.