DPCstruct | MC4203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 176 ± 28 aa |
| Standard deviation of domain lengths | 28.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y4CUD3 | 3-156 | PEDGHAANFARKMSSVTSSEYANLSGMMCWDAVMYCALKAGIIDQKKFDRLRGDQDLVALTDFAVAGPNAMYRLEPGNVIDFFEGAQ… |
| A0A2P5KC96 | 40-241 | PFFPYTENPLKSYQAIRSNWTQAQHRALSEEALGVATDALARDETTGNRVDEKAFSFVSNLMCWNLPRYCAVKAGIISQSEYDSMHA… |
| A0A3N6S3B1 | 175-361 | None |
| A0A2V3XWL5 | 267-412 | None |
| A0A2G2DR13 | 3-136 | None |
| A0A1X7ES13 | 541-709 | None |
| A0A522MM41 | 387-553 | None |
| A0A2E6QN95 | 5-150 | None |
| A0A1R3VKP7 | 43-315 | None |
| A0A4R1N6C6 | 771-932 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.