DPCstruct | MC42022
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 92 ± 13 aa |
| Standard deviation of domain lengths | 12.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 89.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 40.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0032 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S9YKQ3 | 25-119 | DAHIRLAAPRRGAGEEMLRRSYSYSIGQESGAAGDEDAGLIFVSYQADPTTSFIPVQQRLAKSDALAHFTLATSSALFAILPGVVGR… |
| A0A484XBG1 | 152-234 | DVPYYARDPQGDVIALDSHIRLANPRTPETQSSLMMRRGYSYSLGVTNAGQLDMGLLFVCYQHDLEKGFLTVQKRLNGEALEE |
| A0A1P8XM99 | 2-81 | None |
| A0A4V3IW56 | 11-87 | None |
| A0A6S7BHR8 | 1-100 | None |
| A0A379FIU8 | 18-107 | None |
| A0A378F898 | 670-752 | None |
| A0A806J384 | 32-121 | None |
| A0A7C6XK46 | 9-83 | None |
| A0A285V478 | 274-373 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.