DPCstruct | MC42021
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 100 ± 9 aa |
| Standard deviation of domain lengths | 9.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1E1VIN3 | 1-95 | MNEIKIKRELLEKYGLPDCGINGVKLIRDDITDNSRWSIHHEIIFKWTDGKFYRAYYSVGATESQDEAPWEYEDEVECVEVYQVEKM… |
| A0A7S9YFU8 | 1-106 | MAATRAFTRQELEDIGIPYSWDAIPGKAAEQLHEEQIDTRRWVSLHEIVFRAPDDGKAYSVVYAKGLTENQEDTDPWEYEGETIKAT… |
| A0A7W8BTJ2 | 1-110 | None |
| A0A1G8ACW6 | 11-115 | None |
| A0A6B2UTL6 | 1-104 | None |
| A0A6B2UPN3 | 117-213 | None |
| A0A7K2JWL3 | 1-108 | None |
| A0A1T3NT53 | 2-92 | None |
| A0A5M3WGW3 | 74-156 | None |
| A0A286FAP8 | 2-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.