DPCstruct | MC4202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 108 |
|---|---|
| Mean domain length (aa) | 161 ± 25 aa |
| Standard deviation of domain lengths | 24.75 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 98.96 |
| Assigned Pfam label(s) | PF17724- CL0255 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A843V8X4 | 167-307 | PFHRRASTGYAAALLDVARCEGAVEAVERDVRRFSWAVQALLADPHVGEGRKAEAVRRTLEGGGFGRHLVALVRMLVGKGKVGMVGE… |
| A0A2P5K898 | 10-181 | PYAEALFGVASTDRAADLAAWSALVQELAQVARLPEVLSIVSSPKVGRQQVVDVLLAALKSPAKDSSAAKNFVQMLVENHRVQLLPE… |
| A0A4Y9JE43 | 5-112 | None |
| A0A2P6N6K6 | 48-226 | None |
| A0A183KCL9 | 268-451 | None |
| A0A7R9AJZ5 | 89-226 | None |
| A0A7S4KZU6 | 62-253 | None |
| A0A835S8T5 | 57-240 | None |
| A0A0V1BPA3 | 35-219 | None |
| A0A3D2J504 | 9-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.